| BOC Sciences | USA | Inquire | ||
|---|---|---|---|---|
![]() | www.bocsci.com | |||
![]() | +1 (631) 485-4226 | |||
![]() | +1 (631) 614-7828 | |||
![]() | info@bocsci.com | |||
| Chemical manufacturer | ||||
| chemBlink Standard supplier since 2010 | ||||
| Name | L-rhamnulose |
|---|---|
| Synonyms | (3R,4S,5S)-1,3,4,5-tetrahydroxyhexan-2-one |
| Molecular Structure | ![]() |
| Molecular Formula | C6H12O5 |
| Molecular Weight | 164.16 |
| Protein Sequence | PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC |
| CAS Registry Number | 14807-05-7 |
| SMILES | C[C@@H]([C@@H]([C@H](C(=O)CO)O)O)O |
| Density | 1.4±0.1 g/cm3, Calc.* |
|---|---|
| Index of Refraction | 1.532, Calc.* |
| Boiling Point | 444.1±45.0 °C (760 mmHg), Calc.* |
| Flash Point | 236.5±25.2 °C, Calc.* |
| * | Calculated using Advanced Chemistry Development (ACD/Labs) Software. |
| Market Analysis Reports |
| List of Reports Available for L-rhamnulose |