Online Database of Chemicals from Around the World

Rituximab
[CAS# 174722-31-7]

List of Suppliers
Taizhou Crene Biotechnology Co., Ltd. China Inquire
www.pharm-intermediates.com
+86 (576) 8881-3233
8820-5808
+86 13396860566
+86 (576) 8822-9589
sales@pharm-intermediates.com
QQ Chat
Chemical manufacturer since 2011
chemBlink Standard supplier since 2009
BOC Sciences USA Inquire
www.bocsci.com
+1 (631) 485-4226
+1 (631) 614-7828
info@bocsci.com
Chemical manufacturer
chemBlink Standard supplier since 2010
RIA International LLC USA Inquire
www.riausa.net
+1 (973) 581-1282
+1 (973) 581-1283
marketing@riausa.net
ria@riausa.net
Chemical distributor since 1986
chemBlink Standard supplier since 2016
Shanghai Min-biotech Co., Ltd. China Inquire
www.min-biotech.com
+86 15190045345
sales@min-biotech.com
Chemical manufacturer since 2017
chemBlink Standard supplier since 2024
Targetmol China China Inquire
www.targetmol.cn
+86 (400) 820-0310
sales@targetmol.cn
Chemical manufacturer since 2015
chemBlink Standard supplier since 2025

Identification
ClassificationAPI >> Antineoplastic agents >> Other antineoplastic agents
NameRituximab
SynonymsRetuxin; Rituxan
Molecular StructureCAS # 174722-31-7, Rituximab
Molecular FormulaC6416H9874N1688O1987S44
Molecular Weight143858.03
Protein SequenceHeavy chain chimeric$$nl$$QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY$$nl$$NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS$$nl$$AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS$$nl$$SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLG$$nl$$GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY$$nl$$NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD$$nl$$ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR$$nl$$WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK$$nl$$$$nl$$Light chain chimeric$$nl$$QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR$$nl$$FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS$$nl$$DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL$$nl$$SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
CAS Registry Number174722-31-7
EC Number695-706-4
Properties
Melting point61 °C
Safety Data
Hazard Symbolssymbol   GHS08 Warning  Details
Risk StatementsH372  Details
Safety StatementsP260-P264-P270-P319-P501  Details
Hazard Classification
up    Details
HazardClassCategory CodeHazard Statement
Specific target organ toxicity - repeated exposureSTOT RE1H372
up Discovery and Applications
The discovery of rituximab marked a paradigm shift in the treatment of various hematological malignancies and autoimmune diseases. Developed through an innovative biotechnological approach, rituximab is a chimeric monoclonal antibody directed against the CD20 antigen present on B lymphocytes. The development of rituximab began with CD20 being considered a promising therapeutic target because it is selectively expressed on B cells, making it an ideal candidate for antibody-mediated therapy. By specifically targeting CD20-positive B cells, rituximab induces cell death through multiple mechanisms, including antibody-dependent cytotoxicity, complement-dependent cytotoxicity, and apoptosis. This approach to precisely target malignant or dysregulated B cells while sparing normal cells revolutionizes the treatment of diseases characterized by abnormal B cell activity.

Rituximab has become the cornerstone of NHL treatment, and can significantly improve patient outcomes when used alone or in combination with chemotherapy. By selectively targeting CD20-positive lymphoma cells, rituximab enhances the efficacy of chemotherapy and reduces the risk of disease recurrence, resulting in higher response rates and longer survival. For the treatment of chronic lymphocytic leukemia (CLL), rituximab therapy has shown significant efficacy, particularly when combined with chemotherapy regimens. By eliminating malignant B cells, rituximab reduces tumor burden, delays disease progression, and prolongs survival in patients with CLL, providing a valuable treatment option for this challenging disease. Rituximab has emerged as a promising therapy for the treatment of rheumatoid arthritis (RA), a chronic autoimmune disease characterized by inflammation and joint damage. By targeting B cells involved in the pathogenesis of RA, rituximab is effective in reducing disease activity, relieving symptoms, and improving functional outcomes in patients who have failed conventional treatments. Rituximab has shown efficacy in the treatment of autoimmune hemolytic anemia (AIHA) and immune thrombocytopenia (ITP), two autoimmune diseases characterized by the destruction of red blood cells and platelets, respectively. By targeting autoantibody-producing B cells, rituximab helps restore immune tolerance, thereby improving hematological parameters and reducing disease activity. Rituximab has emerged as a promising treatment for neuromyelitis optica spectrum disorder (NMOSD), a rare autoimmune disease affecting the central nervous system. By targeting B cells involved in the pathogenesis of NMOSD, rituximab may reduce disease activity, relapse rates, and disability progression, offering hope to patients with this debilitating disease.

References

none
Market Analysis Reports
List of Reports Available for Rituximab
Related Products
Ritodrine  Ritodrine hydro...  Ritonavir  Ritonavir EP Im...  Ritonavir EP Im...  Ritonavir EP Im...  Ritonavir EP Im...  Ritonavir EP Im...  Ritropirronium ...  Ritrosulfan  Rivaroxaban-13C...  Rivaroxaban  5-R-Rivaroxaban  Rivaroxaban Dio...  Rivaroxaban Hyd...  Rivaroxaban Imp...  Rivaroxaban Imp...  Rivaroxaban Imp...  Rivaroxaban Oxo...  Rivastigmine