| Taizhou Crene Biotechnology Co., Ltd. | China | Inquire | ||
|---|---|---|---|---|
![]() | www.pharm-intermediates.com | |||
![]() | +86 (576) 8881-3233 8820-5808 +86 13396860566 | |||
![]() | +86 (576) 8822-9589 | |||
![]() | sales@pharm-intermediates.com | |||
![]() | QQ Chat | |||
| Chemical manufacturer since 2011 | ||||
| chemBlink Standard supplier since 2009 | ||||
| BOC Sciences | USA | Inquire | ||
|---|---|---|---|---|
![]() | www.bocsci.com | |||
![]() | +1 (631) 485-4226 | |||
![]() | +1 (631) 614-7828 | |||
![]() | info@bocsci.com | |||
| Chemical manufacturer | ||||
| chemBlink Standard supplier since 2010 | ||||
| Shanghai Min-biotech Co., Ltd. | China | Inquire | ||
|---|---|---|---|---|
![]() | www.min-biotech.com | |||
![]() | +86 15190045345 | |||
![]() | sales@min-biotech.com | |||
| Chemical manufacturer since 2017 | ||||
| chemBlink Standard supplier since 2024 | ||||
| Targetmol Chemicals Inc. | USA | Inquire | ||
|---|---|---|---|---|
![]() | www.targetmol.com | |||
![]() | +1 (781) 999-5354 | |||
![]() | +1 (781) 281-9145 | |||
![]() | sales@targetmol.com | |||
| Chemical manufacturer since 2013 | ||||
| chemBlink Standard supplier since 2025 | ||||
| Classification | API >> Antineoplastic agents >> Natural source antineoplastic agents |
|---|---|
| Name | Trastuzumab |
| Synonyms | Herceptin |
| Molecular Structure | ![]() |
| Molecular Formula | C6470H10012N1726O2013S42 |
| Molecular Weight | 145529.81 |
| Protein Sequence | Anti-HER2 Light chain (1 and 2)$$nl$$DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS$$nl$$RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP$$nl$$SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT$$nl$$LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC$$nl$$$$nl$$Anti-HER2 Heavy chain (1 and 2)$$nl$$EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY$$nl$$ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS$$nl$$ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS$$nl$$GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG$$nl$$PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN$$nl$$STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE$$nl$$MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW$$nl$$QQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| CAS Registry Number | 180288-69-1 |
| EC Number | 695-702-2 |
| Melting point | 61 °C, 71 °C |
|---|---|
| Hazard Symbols | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Risk Statements | H360 Details | ||||||||
| Safety Statements | P203-P280-P318-P405-P501 Details | ||||||||
| Hazard Classification | |||||||||
| |||||||||
|
Trastuzumab, also known as Herceptin, was developed in the late 20th century by researchers Genentech, a biotechnology company. The discovery of trastuzumab stemmed from the identification of the HER2/neu (Human Epidermal Growth Factor Receptor 2) gene, which is overexpressed in certain types of breast cancer. Trastuzumab was specifically designed as a monoclonal antibody to target and inhibit the HER2 protein. Trastuzumab revolutionized the treatment of HER2-positive breast cancer, significantly improving survival rates and outcomes for patients. It is used in both early-stage and metastatic HER2-positive breast cancer, often in combination with chemotherapy or other targeted therapies. Trastuzumab has also shown efficacy in HER2-positive gastric cancer, expanding its therapeutic applications beyond breast cancer. References none |
| Market Analysis Reports |
| List of Reports Available for Trastuzumab |