Online Database of Chemicals from Around the World Search | Submit | 中文

Home >> Chemical Listing >> Page 306 >> Pituitary Adenylatecyclase-Activating Peptide-27 (Human)

Pituitary Adenylatecyclase-Activating Peptide-27 (Human) [127317-03-7]

 
Top Active Suppliers
  after selecting multiple suppliers.
BOC Sciences USA Inquire  
      +1 (631) 485-4226
      info@bocsci.com
      Chemical distributor
      chemBlink massive supplier since 2012
      skype
Complete supplier list of Pituitary Adenylatecyclase-Activating Peptide-27 (Human)




Identification
Copyright
CAS # 127317-03-7, Pituitary Adenylatecyclase-Activating Peptide-27 (Human)
Name
Pituitary Adenylatecyclase-Activating Peptide-27 (Human)
Synonyms
PACAP (1-27) (HUMAN, SHEEP, RAT); HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2; PACAP (1-27), HUMAN, OVINE, RAT
Molecular Formula
C142H224N40O39S
Molecular Weight 3147.61
CAS Registry Number
127317-03-7
SMILES
NCCCC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N)CC(C)C)C(C)C)C)C)CC(C)C)Cc1ccc(cc1)O)
InChI
1S/C142H224N40O39S/c1-16-75(10)113(179-108(191)66-156-120(201)102(63-109(192)193)173-135(216)104(67-183)176-119(200)88(146)62-84-65-153-70-157-84)139(220)174-101(58-80-28-18-17-19-29-80)133(214)
down Safety Data
SDS Available
Market Analysis Reports
 
List of Reports Available for Pituitary Adenylatecyclase-Activating Peptide-27 (Human)
 
Related Products
 
2-(Methylthio)-5-Nitro-4-Thiazolamine  Cerium Tungstate(Ce2(Wo4)3)  Chromium Iron Oxide  3-Perfluorohexyl-2-Hydroxypropyl Acrylat...  Manganese Bromide  1,1'-Dibutyrylferrocene  4-(2-Methyl-4-Thiazolyl)-Benzonitrile  (1S,4S)-2-Methyl-2,5-Diazabicyclo[2.2.1]...  (6R,7R)-3-(chloromethyl)-8-oxo-7-[(2-phe...  Cadmium Fluoborate  (2R)-2-[[(Phenylmethoxy)Carbonyl]Amino]-...  3'-(4-Tolysulfonyl)-4'-Aminoacetanilide  Polyglyceryl-3 Isostearate  3-Phenyl-5-(Phenylmethyl)-1,2,4-Triazine...  5-[(4-Methoxyphenyl)Methyl]-3-Phenyl-1,2...  
Copyright ©  chemBlink. All rights reserved. Content Disclaimer | About chemBlink | Contact