Hyaluronidase (sheep testis isoenzyme)
[CAS# 488712-31-8]

Identification

• Classification: Biochemical >> Enzymes and coenzymes
• Name: Hyaluronidase (sheep testis isoenzyme)
• Synonyms: Hyaluronidase (ovine); Vitrase
• Protein Sequence: > Hyaluronidase Sequence; MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM; KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV; EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY; EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ; LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT; YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN; VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD; RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
• Molecular Formula: C₂₄₅₅H₃₇₇₅N₆₁₇O₇₀₄S₂₁
• Molecular Weight: 53870.95
• CAS Registry Number: 488712-31-8 (9001-54-1)
• EC Number: 232-614-1

Discovory and Applicatios

Hyaluronidase (sheep testis isoenzyme) is an enzyme that catalyzes the hydrolysis of hyaluronic acid, a major component of the extracellular matrix. This enzymatic activity plays a crucial role in increasing tissue permeability, facilitating the diffusion of biological and pharmaceutical agents. Isolated from sheep testicular tissue, this specific isoenzyme has been extensively studied for its medical and biotechnological applications.

The discovery of hyaluronidase dates back to the early 20th century when researchers identified its ability to degrade hyaluronic acid, a polysaccharide responsible for maintaining tissue viscosity and integrity. The isolation of the sheep testis isoenzyme provided a valuable alternative to other animal-derived hyaluronidases, offering distinct biochemical properties suited for various applications. Researchers found that the enzyme’s activity could enhance the effectiveness of therapeutic drugs by modifying the extracellular environment.

One of the primary applications of hyaluronidase (sheep testis isoenzyme) is in medicine, where it is used to improve the dispersion and absorption of injected drugs. By breaking down hyaluronic acid, the enzyme facilitates the penetration of local anesthetics, chemotherapeutic agents, and other injectable medications. This property is particularly useful in ophthalmology, where hyaluronidase assists in the administration of intraocular drugs during surgery.

In dermatology and aesthetic medicine, hyaluronidase is widely used to reverse the effects of hyaluronic acid-based dermal fillers. This function provides a corrective measure for patients who experience overcorrection, asymmetry, or complications from filler treatments. The enzyme ensures controlled and efficient degradation of excess filler material, enhancing safety and precision in cosmetic procedures.

Reproductive medicine has also benefited from the use of hyaluronidase. The enzyme naturally plays a role in sperm penetration during fertilization by aiding the breakdown of the cumulus oophorus surrounding the ovum. This understanding has led to the use of hyaluronidase in assisted reproductive technologies, where it facilitates sperm processing and embryo handling in in vitro fertilization procedures.

In biotechnology and cell biology research, hyaluronidase (sheep testis isoenzyme) is utilized to dissociate tissues and obtain single-cell suspensions. This function is critical in cell culture studies, cancer research, and regenerative medicine, where isolating viable cells is necessary for experimental and therapeutic applications.

Despite its broad range of applications, the use of hyaluronidase has raised concerns regarding potential immunogenic reactions in some individuals. While generally well-tolerated, allergic responses to animal-derived enzymes have prompted the development of recombinant human hyaluronidase as an alternative. However, the sheep testis isoenzyme remains widely used due to its established efficacy and availability.

Hyaluronidase (sheep testis isoenzyme) continues to be an essential biochemical tool with significant medical, pharmaceutical, and research applications. Its ability to modulate tissue permeability and enhance drug diffusion has made it indispensable in multiple fields. Ongoing studies aim to optimize its therapeutic benefits and explore new applications, further cementing its role in modern medicine and biotechnology.