Dulaglutide
[CAS# 923950-08-7]

Identification

• Classification: API >> Other chemicals
• Name: Dulaglutide
• Synonyms: LY 2189265; Trulicity
• Protein Sequence: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPA; PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP; REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL; PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT; VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
• Molecular Formula: C₂₆₄₆H₄₀₄₄N₇₀₄O₈₃₆S₁₈
• Molecular Weight: 59669.81
• CAS Registry Number: 923950-08-7

Discovory and Applicatios

Dulaglutide, a medication used in the management of type 2 diabetes, was developed by Eli Lilly and Company. It belongs to a class of drugs known as glucagon-like peptide-1 receptor agonists (GLP-1 RAs), which mimic the action of endogenous incretin hormones to regulate blood sugar levels. The discovery of dulaglutide stemmed from research into novel therapeutic approaches for diabetes management.

Dulaglutide, a glucagon-like peptide-1 receptor agonist, is widely used in the management of type 2 diabetes mellitus. By mimicking the action of endogenous incretin hormones, dulaglutide helps regulate blood sugar levels by stimulating insulin secretion, inhibiting glucagon release, and slowing gastric emptying. It is administered via subcutaneous injection and is indicated as an adjunct to diet and exercise in patients with inadequately controlled diabetes. Clinical studies have demonstrated the efficacy of dulaglutide in reducing hemoglobin A1c levels, promoting weight loss, and lowering the risk of cardiovascular events in patients with type 2 diabetes. Additionally, dulaglutide has shown benefits in improving pancreatic beta-cell function and may offer advantages in terms of dosing frequency and tolerability compared to some other antidiabetic medications.